PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.002G043700.1
Common NamePHAVU_002G043700g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family CPP
Protein Properties Length: 747aa    MW: 81444 Da    PI: 5.9905
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.002G043700.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR512.8e-16457494340
                 TCR   3 kkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                         +k+CnCkkskClk+YCeCfaag++C e C+C+dC+Nk 
  Phvul.002G043700.1 457 CKRCNCKKSKCLKLYCECFAAGVYCIEPCSCQDCFNKP 494
                         89**********************************96 PP

2TCR50.63.8e-16541579139
                 TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                         ++k+gCnCkks+ClkkYCeC++ g+ Cs +C+Ce+CkN 
  Phvul.002G043700.1 541 RHKRGCNCKKSSCLKKYCECYQGGVGCSISCRCEGCKNA 579
                         589***********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011142.3E-18455496IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.266456581IPR005172CRC domain
PfamPF036381.0E-11458493IPR005172CRC domain
SMARTSM011144.4E-17541582IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.2E-11543579IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 747 aa     Download sequence    Send to blast
MDMDTPERNQ ISATLTKFED SPVFNYINSL SPIKPVKSVP ISQTFNSLSF SSPPSVFTSP  60
HVSCLKESRF LRRHIPLGTS KPKVSSEDAS KVHTTSEETL TDSTRHNSSE LQENTDKGIS  120
VEDASIEHIK FSVEPQQTLK YSSCGSPGYD PPLCGDEGNT LLELPDEAAA DETDSSEGHL  180
QKMCQMEPKS EDPECYWDSL VPDGPDMLIF NSPGEAEAFK GLMHKPLDSS IRLSDVMSVL  240
PISTIHNGRK MYFVDSVASG SEHEIGDHCF EPTTTAMDTD QTQDNLADVV LVTSNSNENA  300
NDQLVSVTHR AIRRRCLDFE MANVQRKNSE DNSNAGSSTS NEKQLHPAKL NGNFQRGILQ  360
GIGLHLNALA ALKEYKGIQI ENLSSGTLQI STSIEHQHLS LVPVSSEREL DSSDNGLQPA  420
EDCSQPSVYM AGEDFNKNSS PRKKKRKVET PGETEGCKRC NCKKSKCLKL YCECFAAGVY  480
CIEPCSCQDC FNKPIHEDTV LQTRKQIESR NPLAFAPKVI RSSDSVPEIG DDPNKTPASA  540
RHKRGCNCKK SSCLKKYCEC YQGGVGCSIS CRCEGCKNAF GRKDGSAPVG IETDSEEIEA  600
TEKGVAERAS HKTEIQNTED HPDSATVSTP LRFSRPLLPL PFSSKGKAPI SFVTTISGSA  660
LFSSQKLGKP NSLWSQSKHF QTAPDEEMAD ILLGDTSPIT CIKTSSPNGK RISSPSCDLG  720
SSPSRRGGRK LILQSIPSFP SLTPHP*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1442447KKKRKV
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00433DAPTransfer from AT4G14770Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007157112.10.0hypothetical protein PHAVU_002G043700g
TrEMBLV7CJM50.0V7CJM5_PHAVU; Uncharacterized protein
STRINGGLYMA11G00920.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF26193375
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.11e-134TESMIN/TSO1-like CXC 2